PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 573aa    MW: 62609.4 Da    PI: 8.8587
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234473.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.71.5e-24210263155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kp+++Wt+ LH++F+ a++++ G +kA+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  XP_008234473.1 210 KPKVVWTNSLHNQFLLAIRHI-GLDKAVPKRILEFMNVPGLTRENVASHLQKYRI 263
                     79*******************.********************************6 PP

2Response_reg76.97.2e-26271351109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     +l+vdD+ + + ++  +l+   y +v +++++ +al++l++++  +Dl+++D+ mp+m+G+el k+ +ee  klp+i+++a ++e+ +l+ l+ G
  XP_008234473.1  27 ILVVDDDATTLAIVSAMLKTWSY-QVVSVRNPIDALATLRARKgiFDLVVTDLHMPQMNGFELQKHVHEEF-KLPVIMMSADDKESVILKSLEGG 119
                     89*********************.9999***********99999*************************99.*********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     +  +++Kp++++++ +
  XP_008234473.1 120 VVYYIVKPVSKDDIKN 135
                     ************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.42E-3323142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.6E-3524148No hitNo description
SMARTSM004486.7E-2825137IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.2726141IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2227135IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.54E-2728140No hitNo description
SuperFamilySSF466898.96E-19207267IPR009057Homeodomain-like
PROSITE profilePS5129410.115207266IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-25208267IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-25210263IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MDAATERSEF RQSSANTKPS FVDMINILVV DDDATTLAIV SAMLKTWSYQ VVSVRNPIDA  60
LATLRARKGI FDLVVTDLHM PQMNGFELQK HVHEEFKLPV IMMSADDKES VILKSLEGGV  120
VYYIVKPVSK DDIKNVWQYA VAAKKGKSVT IEEIESAPGE APGEVEDGSS ETSSDTDEEK  180
QEKKAEAKVK KERKRHREDD NEERMVAPKK PKVVWTNSLH NQFLLAIRHI GLDKAVPKRI  240
LEFMNVPGLT RENVASHLQK YRIFLKRVAE KARLSKCLSE RVFRSSFALG HPALVFNNVQ  300
RDQYYSQLLN PQQMGTSIAS TFQPSAGNGN TLALTAAASN NLGSIQFPNY HQSSSSNSSR  360
SFPQLIGSGQ SRLLSNNQAN ILCQQPMLGN GNGDQLLCQA NCRTAAFGVQ QLMNTFGNGG  420
MPFGLMNNNI GLTNNNIGTN SLMQVHPQQS QPRHNGVFTF TNNPFSYNFA TSGNQISSSY  480
TPLSSSFENM GSNVNNVNQQ VPNSSHQLVS NFAGSQIMSS SGRELVGLMG SQPAGMLNGN  540
NNGIFNSGYM AQLGASSSSM SSSAGAATAR REC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-23207269264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234473.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLM5X7A70.0M5X7A7_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0015s13860.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.15e-58response regulator 2